PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN36528.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 479aa    MW: 53070.5 Da    PI: 6.0588
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN36528.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding582.1e-182673148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +l ++vk++G g+W+++ +  g+ R++k+c++rw ++l
       KHN36528.1 26 KGPWTPEEDAILMEYVKKHGEGNWNSVQKNSGLLRCGKSCRLRWANHL 73
                     79******************************99**********9986 PP

2Myb_DNA-binding45.91.3e-1479122146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE++ ++d++ +lG++ W++ a+ ++ gRt+ ++k++w++
       KHN36528.1  79 KGAFSPEEEQVIIDLHSKLGNK-WARMAAQLP-GRTDDEIKNFWNT 122
                      799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.7312177IPR017930Myb domain
SuperFamilySSF466891.42E-2924120IPR009057Homeodomain-like
SMARTSM007173.3E-152575IPR001005SANT/Myb domain
PfamPF002498.6E-172673IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.9E-252780IPR009057Homeodomain-like
CDDcd001671.47E-122873No hitNo description
PROSITE profilePS5129419.83178128IPR017930Myb domain
SMARTSM007171.1E-1378126IPR001005SANT/Myb domain
PfamPF002493.9E-1379122IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-2481127IPR009057Homeodomain-like
CDDcd001671.51E-981122No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009555Biological Processpollen development
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0090406Cellular Componentpollen tube
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 479 aa     Download sequence    Send to blast
MARTVSNNDD ETAAKEEGEV KDGVRKGPWT PEEDAILMEY VKKHGEGNWN SVQKNSGLLR  60
CGKSCRLRWA NHLRPNLKKG AFSPEEEQVI IDLHSKLGNK WARMAAQLPG RTDDEIKNFW  120
NTRMKRRQRA GLPIYPPEVH AEANAYHLQH HRYLEQQQPP PYSSSSFSLL LSSCYPKKLN  180
DPNQIHHHSS ANPMQNQPDH SADRSINPSQ QFKFSNENST GNNGNFAFPM SPLSPYGSSS  240
STLLNHSFGG DHGGFIAGSP YEQPFPLVQG STTDISSNQT PTPASSYASG VDGLMGASSM  300
VNNNNNNNDY YEVAPLSPHQ GNSGLLDALV MEAQGLYHNE KSRSEEDLNL AGKLSCKRKN  360
MEYAEEGGTV PAGVSAMKKN SGNSSNESQR DDDISSSQLS KGKKQIGEDP LEEMNGMDDD  420
LVSLLNQFPL EMPMPEWYRR GENQSLGLEN QPKASSPDPA DHEHAWTLGT CWNNMPRIC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28261277107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00287DAPTransfer from AT2G32460Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003541947.20.0PREDICTED: uncharacterized protein LOC100784779
TrEMBLA0A0B2RVP00.0A0A0B2RVP0_GLYSO; Transcription factor GAMYB
STRINGGLYMA13G38521.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF99493240
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.16e-80myb domain protein 101
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]